Loading...
Statistics
Advertisement

Oneminutekent.com

Advertisement
Conversion Technology Metas Server
Oneminutekent.com is hosted in United Kingdom . Oneminutekent.com uses HTTPS protocol. Number of used technologies: 3. First technologies: Html, Php, Swf Object, Number of used javascripts: 2. First javascripts: Library.js, AC_RunActiveContent.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache/2.4.18 (Unix).

Technologies in use by Oneminutekent.com

Technology

Number of occurences: 3
  • Html
  • Php
  • Swf Object

Advertisement

Javascripts

Number of occurences: 2
  • library.js
  • AC_RunActiveContent.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4.18 (Unix)

Powered by

  • PHP/5.3.28

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Oneminutekent.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.secure-secure.co.uk
    • subject:
      • OU: Domain Control Validated
      • CN: *.secure-secure.co.uk
    • hash: 05894cd2
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: GlobalSign Domain Validation CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492208244245080359488883509239508541224455
    • validFrom: 140410074728Z
    • validTo: 180110143703Z
    • validFrom_time_t: 1397116048
    • validTo_time_t: 1515595023
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:*.secure-secure.co.uk, DNS:secure-secure.co.uk
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl.globalsign.com/gs/gsdomainvalsha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure.globalsign.com/cacert/gsdomainvalsha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsdomainvalsha2g2
      • subjectKeyIdentifier: 48:1D:3E:03:0D:A9:85:F3:2B:EB:B6:98:19:79:2F:F1:7D:76:B4:B4
      • authorityKeyIdentifier: keyid:EA:4E:7C:D4:80:2D:E5:15:81:86:26:8C:82:6D:C0:98:A4:CF:97:0F

Meta - Oneminutekent.com

Number of occurences: 3
  • Name:
    Content: no
  • Name: description
    Content:
  • Name: keywords
    Content:

Server / Hosting

  • IP: 79.170.44.111
  • Latitude: 51.50
  • Longitude: -0.12
  • Country: United Kingdom

Rname

  • ns.mainnameserver.com
  • ns2.mainnameserver.com
  • mail.oneminutekent.com

Target

  • hostmaster.mainnameserver.com

HTTP Header Response

HTTP/1.1 200 OK Date: Fri, 29 Apr 2016 15:43:22 GMT Server: Apache/2.4.18 (Unix) X-Powered-By: PHP/5.3.28 Content-Type: text/html

DNS

host: oneminutekent.com
  1. class: IN
  2. ttl: 10800
  3. type: A
  4. ip: 79.170.44.111
host: oneminutekent.com
  1. class: IN
  2. ttl: 10800
  3. type: NS
  4. target: ns.mainnameserver.com
host: oneminutekent.com
  1. class: IN
  2. ttl: 10800
  3. type: NS
  4. target: ns2.mainnameserver.com
host: oneminutekent.com
  1. class: IN
  2. ttl: 10800
  3. type: SOA
  4. mname: ns.mainnameserver.com
  5. rname: hostmaster.mainnameserver.com
  6. serial: 2012111875
  7. refresh: 86400
  8. retry: 604800
  9. expire: 2419200
  10. minimum-ttl: 10800
host: oneminutekent.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 10
  5. target: mail.oneminutekent.com
host: oneminutekent.com
  1. class: IN
  2. ttl: 10800
  3. type: TXT
  4. txt: v=spf1 a mx a:mailforwards.extendcp.co.uk ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.neminutekent.com, www.obneminutekent.com, www.bneminutekent.com, www.ohneminutekent.com, www.hneminutekent.com, www.ogneminutekent.com, www.gneminutekent.com, www.ojneminutekent.com, www.jneminutekent.com, www.omneminutekent.com, www.mneminutekent.com, www.o neminutekent.com, www. neminutekent.com, www.ovneminutekent.com, www.vneminutekent.com, www.oeminutekent.com, www.onneminutekent.com, www.oneminutekent.com, www.onheminutekent.com, www.oheminutekent.com, www.onjeminutekent.com, www.ojeminutekent.com, www.onkeminutekent.com, www.okeminutekent.com, www.onleminutekent.com, www.oleminutekent.com, www.on eminutekent.com, www.o eminutekent.com, www.onminutekent.com, www.onexminutekent.com, www.onxminutekent.com, www.onesminutekent.com, www.onsminutekent.com, www.onewminutekent.com, www.onwminutekent.com, www.onerminutekent.com, www.onrminutekent.com, www.onefminutekent.com, www.onfminutekent.com, www.onevminutekent.com, www.onvminutekent.com, www.onecminutekent.com, www.oncminutekent.com, www.oneqminutekent.com, www.onqminutekent.com, www.oneaminutekent.com, www.onaminutekent.com, www.oneyminutekent.com, www.onyminutekent.com, www.oneinutekent.com, www.onempinutekent.com, www.onepinutekent.com, www.onemoinutekent.com, www.oneoinutekent.com, www.onemiinutekent.com, www.oneiinutekent.com, www.onemkinutekent.com, www.onekinutekent.com, www.onem.inutekent.com, www.one.inutekent.com, www.onemuinutekent.com, www.oneuinutekent.com, www.onemjinutekent.com, www.onejinutekent.com, www.onemninutekent.com, www.oneninutekent.com, www.onem-inutekent.com, www.one-inutekent.com, www.onemnutekent.com, www.onemirnutekent.com, www.onemrnutekent.com, www.onemifnutekent.com, www.onemfnutekent.com, www.onemivnutekent.com, www.onemvnutekent.com, www.onemiknutekent.com, www.onemknutekent.com, www.onemi,nutekent.com, www.onem,nutekent.com, www.onemibnutekent.com, www.onembnutekent.com, www.onemignutekent.com, www.onemgnutekent.com, www.onemitnutekent.com, www.onemtnutekent.com, www.onemiynutekent.com, www.onemynutekent.com, www.onemiunutekent.com, www.onemunutekent.com, www.onemijnutekent.com, www.onemjnutekent.com, www.onemimnutekent.com, www.onemmnutekent.com, www.oneminnutekent.com, www.onemnnutekent.com, www.onemiutekent.com, www.oneminnutekent.com, www.oneminutekent.com, www.oneminhutekent.com, www.onemihutekent.com, www.oneminjutekent.com, www.onemijutekent.com, www.oneminkutekent.com, www.onemikutekent.com, www.oneminlutekent.com, www.onemilutekent.com, www.onemin utekent.com, www.onemi utekent.com, www.onemintekent.com, www.oneminuwtekent.com, www.oneminwtekent.com, www.oneminuetekent.com, www.oneminetekent.com, www.oneminustekent.com, www.oneminstekent.com, www.oneminuatekent.com, www.oneminatekent.com, www.oneminuekent.com, www.oneminutqekent.com, www.oneminuqekent.com, www.oneminutaekent.com, www.oneminuaekent.com, www.oneminut ekent.com, www.oneminu ekent.com, www.oneminutwekent.com, www.oneminuwekent.com, www.oneminuteekent.com, www.oneminueekent.com, www.oneminutzekent.com, www.oneminuzekent.com, www.oneminutxekent.com, www.oneminuxekent.com, www.oneminutcekent.com, www.oneminucekent.com, www.oneminutkent.com, www.oneminutexkent.com, www.oneminutxkent.com, www.oneminuteskent.com, www.oneminutskent.com, www.oneminutewkent.com, www.oneminutwkent.com, www.oneminuterkent.com, www.oneminutrkent.com, www.oneminutefkent.com, www.oneminutfkent.com, www.oneminutevkent.com, www.oneminutvkent.com, www.oneminuteckent.com, www.oneminutckent.com, www.oneminuteqkent.com, www.oneminutqkent.com, www.oneminuteakent.com, www.oneminutakent.com, www.oneminuteykent.com, www.oneminutykent.com, www.oneminutektent.com, www.oneminutetent.com, www.oneminutekent.com, www.oneminutekgent.com, www.oneminutegent.com, www.oneminutekbent.com, www.oneminutebent.com, www.oneminuteknent.com, www.oneminutenent.com, www.oneminutekhent.com, www.oneminutehent.com, www.oneminutekyent.com, www.oneminuteyent.com, www.oneminuteklent.com, www.oneminutelent.com, www.oneminutekoent.com, www.oneminuteoent.com, www.oneminutekuent.com, www.oneminuteuent.com, www.oneminutekient.com, www.oneminuteient.com, www.oneminutekment.com, www.oneminutement.com,

Other websites we recently analyzed

  1. creactioninc.com
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  2. Keller Williams Realty Professional Partners rentals and property management - single family homes, townhomes, condos, apartments rent and lease in {merge-region}.
    Keller Williams Realty Professional Partners serves the {merge-region} area with {merge-specialization}.
    Dallas (United States) - 75.126.183.70
    Server software: Apache
    Technology: CloudFlare, CSS, Google Font API, Html, Iframe, Javascript, jQuery, jQuery UI, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 3
  3. promastix.com
    Selling Insights based theme
    Lansing (United States) - 67.227.192.181
    Server software: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: CSS, Flexslider, Html, Html5, Javascript, Google Analytics
    Number of Javascript: 5
    Number of meta tags: 4
  4. 给料网-每天都免费！
    Central District (Hong Kong) - 103.27.176.52
    Server software: IIS
    Technology: Html, Php
    Number of meta tags: 1
  5. 8560.de - Diese Website steht zum Verkauf! - Informationen zum Thema 8 560.
    Diese Website steht zum Verkauf! 8560.de ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 8560.de alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.90
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  6. Charlemagne
    United Kingdom - 185.19.14.71
    Server software: Microsoft-IIS/7.5
    Technology: Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Tagmanager
    Number of Javascript: 9
    Number of meta tags: 3
  7. academiccredittransferpathway.ca
    Scottsdale (United States) - 184.168.221.46
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  8. Jich.de
    Germany - 88.198.231.9
    Server software: Apache/2.4.10 (Debian)
    Technology: CSS, Html, Html5, Javascript, jQuery
    Number of Javascript: 15
    Number of meta tags: 4
  9. nutritionnews.net
    Switzerland - 141.8.225.124
    Server software: Apache
    Technology: Html
  10. Home
    Servicios de Transporte Generales
    Scottsdale (United States) - 107.180.25.128
    Server software: Apache/2.4.23
    Technology: Carousel, CSS, Font Awesome, Html, Html5, Javascript, Php
    Number of Javascript: 14
    Number of meta tags: 4

Check Other Websites